PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G038200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 346aa    MW: 38403.4 Da    PI: 5.1612
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G038200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.54.2e-301432723128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.kvkaeekewyfFskrdkkyatgkrknra......tksgyWkat 86 
                         pG+rFhPtd el+  yL++k +g+++++ +++k++++++++P++ ++ + ++ + +wy F++r++ky++gkr+ r+       k gyWk+ 
  Brast06G038200.1.p 143 PGVRFHPTDTELI-GYLRRKYDGRRMPA-DIVKDFNVFHHHPSSVQEiCGDSVDGSWYVFTPRSRKYEEGKRPDRSvvcegsRKIGYWKSN 231
                         9************.9*************.99**************95244445569*******************6566665569****** PP

                 NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          k+ ++ + +g++vg  + L+f  g++p+ge t+W m+eyr+
  Brast06G038200.1.p 232 VKEADISV-RGKVVGKVNALTFALGDQPRGELTRWRMKEYRM 272
                         *******9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.378141311IPR003441NAC domain
SuperFamilySSF1019413.01E-33143311IPR003441NAC domain
PfamPF023655.1E-16143272IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTGRSLDADN VNAQPGAPLP VAPSSSFSLP LLPSSSWSST WQTPCGDELA AAPPAEPGNP  60
PAGRRRGRPR GSTNKPKVAN KAAAKPKPKL DSPSPGEERP TTGHPSTGAA TTPAVAGEEE  120
EEEEEEEEED WDSDEEYAAT DIPGVRFHPT DTELIGYLRR KYDGRRMPAD IVKDFNVFHH  180
HPSSVQEICG DSVDGSWYVF TPRSRKYEEG KRPDRSVVCE GSRKIGYWKS NVKEADISVR  240
GKVVGKVNAL TFALGDQPRG ELTRWRMKEY RMPDCQREPE RDPKRRKASR RNLGPDSMLL  300
DDWVICKLFY RRNKKDQEVD VGGQQDGEVN EDVDKEDDGK EGDTK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-2614331717174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229598.21e-118PREDICTED: uncharacterized protein LOC104582026
RefseqXP_014753160.11e-118PREDICTED: uncharacterized protein LOC104582026
TrEMBLA0A0Q3KUZ11e-118A0A0Q3KUZ1_BRADI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131302130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-27NAC domain containing protein 32